PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 518aa    MW: 58080.4 Da    PI: 7.4034
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99949.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W  ++++ g+ R++k+c++rw +yl
       KHM99949.1 14 RGLWSPEEDEKLIRYITTHGYGCWGEVPEKAGLLRCGKSCRLRWINYL 61
                     788*****************************99************97 PP

2Myb_DNA-binding51.62.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       KHM99949.1  67 RGRFTPEEEKLIITLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.241961IPR017930Myb domain
SuperFamilySSF466897.49E-2912108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-231568IPR009057Homeodomain-like
CDDcd001671.25E-101761No hitNo description
PROSITE profilePS5129425.59262116IPR017930Myb domain
SMARTSM007171.6E-1666114IPR001005SANT/Myb domain
PfamPF002495.4E-1567111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2569116IPR009057Homeodomain-like
CDDcd001671.18E-1169112No hitNo description
PfamPF035019.3E-44338429IPR005326Plectin/S10, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005840Cellular Componentribosome
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWGEV PEKAGLLRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIT LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKTS  120
VSSTTIAQSI DHNSSHQFNY NSNLVLDHFP NQDNNLQTKP PVQEALFSST CPLFIFDTTD  180
SLEPGTATDC KSSTVRAEHF HQDAVGLSSE TWNSSHHQVH ALPPLTVSVG LDTSNYLPPL  240
IEHVDNMVPI EVQSCTIDEQ GDIALECLQR QGLNEWVETQ QQCPNFLFWD SVEGQLGGEE  300
LAPNSSNVEA NTLSPFPCSL TLFPNFHCLR FHLATMIIPE KNRKEICKYL FQEGVCFAKK  360
DFNLAKHPEI DVPNLQVIKL MQSFKSREYV RETFAWMHYY WFLTNDGIEF LRTYLNLPSE  420
IVPATLKKQA KPPGRPFGGP SGDRPRGPPR FEGERRFGGD RDGYRGGPRG GPGGDFGGDK  480
GGAPADYRPS FGGPGGRPGF GRGSGGFGAP TSSNLPQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v7e_BK2e-77336491115640S ribosomal protein S10E
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0900660.0BT090066.1 Soybean clone JCVI-FLGm-3F3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014630781.10.0PREDICTED: uncharacterized protein LOC100499910 isoform X1
TrEMBLA0A0B2NS980.0A0A0B2NS98_GLYSO; 40S ribosomal protein S10
STRINGGLYMA05G37460.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.13e-97myb domain protein 103
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]